Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLT
    • Amino acids
      181 to 214

Specifications

Our Abpromise guarantee covers the use of ab79512 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 1X PBS

  • Reconstitution
    Re-dissolve the powder with 1ml sterile water to give 1mg/ml.

General Info

  • Alternative names
    • Mitochondrial uncoupling protein 3
    • SLC25A9
    • Solute carrier family 25 member 9
    • UCP 3
    • UCP3
    • UCP3_HUMAN
    • Uncoupling protein 3
    • Uncoupling protein 3 mitochondrial proton carrier
    see all
  • Function
    UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. As a result, energy is dissipated in the form of heat. May play a role in the modulation of tissue respiratory control. Participates in thermogenesis and energy balance.
  • Tissue specificity
    Only in skeletal muscle and heart. Is more expressed in glycolytic than in oxidative skeletal muscles.
  • Involvement in disease
    Defects in UCP3 may be involved in obesity (OBESITY) [MIM:601665]. It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat.
  • Sequence similarities
    Belongs to the mitochondrial carrier family.
    Contains 3 Solcar repeats.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Recombinant Human UCP3 protein images

  • 20% SDS PAGE gel. Commassie blue staining.

References for Recombinant Human UCP3 protein (ab79512)

ab79512 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab79512.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up