Recombinant Human UDP glucose dehydrogenase protein (ab96771)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEMFEIKKICCIG AGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVV ESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEA CARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPE FLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILTT NTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRI GNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYWQQVIDMNDYQR RRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSSIYISKYLMDEG AHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAV VICTEWDMFKELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIET IGKKVSSKRIPYAPSGEIPKFSLQDPPNKKPKV
    • Molecular weight
      60 kDa including tags
    • Amino acids
      1 to 494
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab96771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab96771 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium fluoride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • GDH
    • UDP Glc dehydrogenase
    • UDP GlcDH
    • UDP glucose 6 dehydrogenase
    • UDP-Glc dehydrogenase
    • UDP-GlcDH
    • UDP-glucose 6-dehydrogenase
    • UDP-glucose dehydrogenase
    • UDPGDH
    • UGD
    • Ugdh
    • UGDH_HUMAN
    • Uridine diphospho glucose dehydrogenase
    see all
  • Function
    Involved in the biosynthesis of glycosaminoglycans; hyaluronan, chondroitin sulfate, and heparan sulfate.
  • Tissue specificity
    Widely expressed.
  • Pathway
    Nucleotide-sugar biosynthesis; UDP-alpha-D-glucuronate biosynthesis; UDP-alpha-D-glucuronate from UDP-alpha-D-glucose: step 1/1.
  • Sequence similarities
    Belongs to the UDP-glucose/GDP-mannose dehydrogenase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab96771 at approximately 59.5kDa (3µg).

References

ab96771 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab96771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up