Recombinant Human UDP glucose dehydrogenase protein (ab96771)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO60701
    • SpeciesHuman
    • SequenceMRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEMFEIKKICCIG AGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVV ESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEA CARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPE FLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILTT NTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRI GNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYWQQVIDMNDYQR RRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSSIYISKYLMDEG AHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAV VICTEWDMFKELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIET IGKKVSSKRIPYAPSGEIPKFSLQDPPNKKPKV
    • Molecular weight60 kDa including tags
    • Amino acids1 to 494
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab96771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity> 95 % SDS-PAGE.
    ab96771 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium fluoride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • GDH
    • UDP Glc dehydrogenase
    • UDP GlcDH
    • UDP glucose 6 dehydrogenase
    • UDP-Glc dehydrogenase
    • UDP-GlcDH
    • UDP-glucose 6-dehydrogenase
    • UDP-glucose dehydrogenase
    • UDPGDH
    • UGD
    • Ugdh
    • UGDH_HUMAN
    • Uridine diphospho glucose dehydrogenase
    see all
  • FunctionInvolved in the biosynthesis of glycosaminoglycans; hyaluronan, chondroitin sulfate, and heparan sulfate.
  • Tissue specificityWidely expressed.
  • PathwayNucleotide-sugar biosynthesis; UDP-alpha-D-glucuronate biosynthesis; UDP-alpha-D-glucuronate from UDP-alpha-D-glucose: step 1/1.
  • Sequence similaritiesBelongs to the UDP-glucose/GDP-mannose dehydrogenase family.
  • Information by UniProt

Recombinant Human UDP glucose dehydrogenase protein images

  • 15% SDS-PAGE showing ab96771 at approximately 59.5kDa (3µg).

References for Recombinant Human UDP glucose dehydrogenase protein (ab96771)

ab96771 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab96771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"