Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9Y3C8
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMADEATRRVVSEIPVLKTNAGPRDRELWVQ RLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEF DIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVP KFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ
    • Molecular weight22 kDa including tags
    • Amino acids1 to 167
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107151 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab107151 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • CGI-126
    • HSPC155
    • Ubiquitin fold modifier conjugating enzyme 1
    • Ubiquitin-fold modifier-conjugating enzyme 1
    • UFC1
    • UFC1_HUMAN
    • Ufm1 conjugating enzyme 1
    • Ufm1-conjugating enzyme 1
    see all
  • FunctionE2-like enzyme which forms an intermediate with UFM1 via a thioester linkage.
  • Sequence similaritiesBelongs to the ubiquitin-conjugating enzyme family. UFC1 subfamily.
  • Information by UniProt

Recombinant Human UFC1 protein images

  • 15% SDS-PAGE showing ab107151 (3µg).

References for Recombinant Human UFC1 protein (ab107151)

This product has been referenced in:
  • Tellermann A  et al. Autoantibodies binding to ubiquitin-fold modifier-conjugating enzyme 1 (Ufc1) and pleckstrin homology domain containing, family G (with RhoGef domain) member 2 (Plekhg2) are associated with mycobacterial infections. HIV Med 16:114-21 (2015). Read more (PubMed: 25213431) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab107151.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"