Recombinant human UFM1 protein (Agarose) (ab190029)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAII TNDGIGINPA QTAGNVFLKHGSELRIIPRDRVGSC
    • Molecular weight
      9 kDa
    • Amino acids
      1 to 85
    • Additional sequence information
      NP_057701.
  • Conjugation
    Agarose

Specifications

Our Abpromise guarantee covers the use of ab190029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Purification

    Functional Studies

  • Form
    Liquid
  • Additional notes

    UFM1 covalently coupled to agarose beads via primary amines allowing for a fully functional C-terminus. Useful for isolation and capture of UFM1 interacting proteins and/or enzymes that have an affinity for this ubiquitin-like protein.

    Equilibrate resin by washing with 5-10 mL desired start buffer. Binding and elution of material is dependent on individual experimental conditions. The agarose can be re-used for at least 5-10 applications if properly maintained. After use, clean resin with 5 mL 50 mM Tris pH 9.0, 1M KCL. Remove cleaning solution by washing resin with 5 mL storage buffer. Resin should be stored at 4°C and 0.01% sodium azide can be used as a bacteriostatic agent.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C. Do Not Freeze.

    Constituents: 1.19% HEPES, 1.46% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • BM 002
    • BM002
    • C13orf20
    • Chromosome 13 open reading frame 20
    • Ubiquitin fold modifier 1
    • Ubiquitin-fold modifier 1
    • UFM1
    • UFM1_HUMAN
    see all
  • Function
    Ubiquitin-like modifier protein which binds to a number of target proteins, such as DDRGK1.
  • Sequence similarities
    Belongs to the UFM1 family.
  • Cellular localization
    Nucleus. Cytoplasm. Predominantly nuclear. Also expressed diffusely in the cytoplasm.
  • Information by UniProt

References

ab190029 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190029.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up