Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEH TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN ISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLN KTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKES LLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVS NIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEG KLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDM EIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSD LLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIP DMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVS GNLRILDH
    • Amino acids
      1 to 508
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • pHC379
    • UDP glucose diphosphorylase
    • UDP glucose pyrophosphorylase
    • UDP glucose pyrophosphorylase 1
    • UDP glucose pyrophosphorylase 2
    • UDP-glucose pyrophosphorylase
    • UDPG
    • UDPGP
    • UDPGP 2
    • UDPGP2
    • UGP 1
    • UGP 2
    • UGP1
    • Ugp2
    • UGPA_HUMAN
    • UGPase
    • UGPase 2
    • UGPP 1
    • UGPP 2
    • UGPP1
    • UGPP2
    • Uridyl diphosphate glucose pyrophosphorylase 1
    • Uridyl diphosphate glucose pyrophosphorylase 2
    • UTP glucose 1 phosphate uridyltransferase
    • UTP glucose 1 phosphate uridylyltransferase
    • UTP glucose 1 phosphate uridylyltransferase 2
    • UTP--glucose-1-phosphate uridylyltransferase
    see all
  • Function
    Plays a central role as a glucosyl donor in cellular metabolic pathways.
  • Sequence similarities
    Belongs to the UDPGP type 1 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab159776 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159776 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up