Recombinant Human UGT1A6 protein (ab162789)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQS FGNNHFAERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFKESK
    • Amino acids
      44 to 143
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GNT1
    • HLUGP
    • HLUGP1
    • Phenol metabolizing UDP glucuronosyltransferase
    • Phenol-metabolizing UDP-glucuronosyltransferase
    • UD16_HUMAN
    • UDP glucuronosyltransferase 1 family polypeptide A6
    • UDP glucuronosyltransferase 1A6
    • UDP glycosyltransferase 1 family polypeptide A6
    • UDP-glucuronosyltransferase 1-6
    • UDP-glucuronosyltransferase 1-F
    • UDP-glucuronosyltransferase 1A6
    • UDPGT
    • UDPGT 1-6
    • UGT 1F
    • UGT-1F
    • UGT1
    • UGT1 06
    • UGT1*6
    • UGT1-06
    • UGT1.6
    • UGT1A6
    • UGT1A6S
    • UGT1F
    see all
  • Function
    UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isoform has specificity for phenols.
  • Tissue specificity
    Expressed in skin, kidney and liver.
  • Sequence similarities
    Belongs to the UDP-glycosyltransferase family.
  • Cellular localization
    Microsome. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab162789 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162789 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up