Recombinant Human UGT2B15 protein (ab159780)

Overview

  • Product name
    Recombinant Human UGT2B15 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLN KKLMMKLQESKFDVILADALNPCGEL
    • Amino acids
      85 to 160
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 2.4.1.17
    • HLUG4
    • UDB15_HUMAN
    • UDP glucuronosyltransferase 2 family polypeptide B15
    • UDP glucuronosyltransferase 2 family, member B15
    • UDP glucuronosyltransferase 2 family, member B8
    • UDP glucuronosyltransferase 2B15
    • UDP glucuronosyltransferase UGT2B15
    • UDP glucuronyltransferase family 2 beta 15
    • UDP glycosyltransferase 2 family, member B15
    • UDP glycosyltransferase 2B15
    • UDP-glucuronosyltransferase 2B15
    • UDP-glucuronosyltransferase 2B8
    • UDPGT 2B15
    • UDPGT 2B8
    • UDPGT2B15
    • UDPGTh 3
    • UDPGTh-3
    • UDPGTH3
    • UGT2B15
    • UGT2B8
    • Uridine diphosphate glucuronosyltransferase 2 family, member B8
    • Uridine diphosphate glycosyltransferase 2 family, member B15
    see all
  • Function
    UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme displays activity toward several classes of xenobiotic substrates, including simple phenolic compounds, 7-hydroxylated coumarins, flavonoids, anthraquinones, and certain drugs and their hydroxylated metabolites. It also catalyzes the glucuronidation of endogenous estrogens and androgens.
  • Tissue specificity
    Expressed in many tissues. Present in liver, prostate and testis.
  • Sequence similarities
    Belongs to the UDP-glycosyltransferase family.
  • Cellular localization
    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab159780 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up