Recombinant Human UGT2B7 protein (ab152786)

Overview

  • Product name
    Recombinant Human UGT2B7 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSI FGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCS
    • Molecular weight
      36 kDa including tags
    • Amino acids
      69 to 157

Specifications

Our Abpromise guarantee covers the use of ab152786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • UDP glucuronosyltransferase 2 family, member B7
    • 3
    • 3 4 catechol estrogen specific
    • 3,4 catechol estrogen specific UDPGT
    • 4-catechol estrogen-specific UDPGT
    • UD2B7_HUMAN
    • UDP glucuronosyltransferase 2 family, polypeptide B7
    • UDP glucuronosyltransferase 2 family polypeptide B7
    • UDP glucuronosyltransferase 2 family, member B9
    • UDP glucuronosyltransferase 2B7
    • UDP glucuronosyltransferase2 family, polypeptide B7
    • UDP glucuronyltransferase family 2 beta 7
    • UDP glycosyltransferase 2 family polypeptide B7
    • UDP-glucuronosyltransferase 2B7
    • UDP-glucuronosyltransferase 2B9
    • UDPGT
    • UDPGT 2B7
    • UDPGT 2B9
    • UDPGT2B7
    • UDPGTh 2
    • UDPGTh-2
    • UDPGTh2
    • UGT2B7
    • UGT2B9
    • UGTB2B9
    • uridine diphosphate glycosyltransferase 2 family, member B7
    • uridine diphosphate glycosyltransferase 2 family, member B9
    see all
  • Function
    UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.
    Its unique specificity for 3,4-catechol estrogens and estriol suggests it may play an important role in regulating the level and activity of these potent and active estrogen metabolites.
  • Sequence similarities
    Belongs to the UDP-glycosyltransferase family.
  • Cellular localization
    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152786 stained with Coomassie Blue.

References

ab152786 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up