Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNV CKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR
    • Molecular weight
      37 kDa including tags
    • Amino acids
      694 to 793

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112411 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    This product is useful for Antibody Production and Protein Array
  • Applications

    Western blot

    ELISA

    Peptide Array

  • Form
    Liquid
  • Additional notes
    This product is useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced.

General Info

  • Alternative names
    • Ac2-121
    • AL022808
    • E3 ubiquitin-protein ligase UHRF1
    • EC 6.3.2.-
    • FLJ21925
    • hNP95
    • hUHRF1
    • HuNp95
    • ICBP90
    • Inverted CCAAT box binding protein of 90 kDa
    • Inverted CCAAT box binding protein, 90-kD
    • Inverted CCAAT box-binding protein of 90 kDa
    • Liver regeneration-related protein LRRG126
    • MGC138707
    • NP95
    • Nuclear phosphoprotein 95
    • Nuclear phosphoprotein, 95-KD
    • Nuclear protein 95
    • Nuclear zinc finger protein Np95
    • RING finger protein 106
    • RNF106
    • TDRD22
    • Transcription factor ICBP90
    • Ubiquitin like containing PHD and RING finger domains protein 1
    • Ubiquitin like PHD and RING finger domain containing protein 1
    • Ubiquitin-like PHD and RING finger domain-containing protein 1
    • Ubiquitin-like protein containing PHD and RING finger domains 1
    • Ubiquitin-like with PHD and ring finger domains 1
    • Ubiquitin-like, containing PHD and RING finger domains, 1
    • Ubiquitin-like-containing PHD and RING finger domains protein 1
    • UHRF1
    • UHRF1_HUMAN
    see all
  • Function
    Putative E3 ubiquitin-protein ligase. May participate in methylation-dependent transcriptional regulation. Binds to inverted 5'-CCAAT-3' box 2 in the TOP2A promoter, and activates TOP2A expression. Important for G1/S transition. May be involved in DNA repair and chromosomal stability.
  • Tissue specificity
    Expressed in thymus, bone marrow, testis, lung and heart. Overexpressed in breast cancer.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 PHD-type zinc finger.
    Contains 2 RING-type zinc fingers.
    Contains 1 ubiquitin-like domain.
    Contains 1 YDG domain.
  • Developmental stage
    Expressed in fetal thymus, liver and kidney.
  • Domain
    The RING finger is required for ubiquitin ligase activity.
    The YDG domain mediates the interaction with histone H3.
  • Post-translational
    modifications
    Phosphorylated on serine residues. Phosphorylation may enhance DNA-binding activity.
    Ubiquitinated; which leads to proteasomal degradation. Polyubiquitination may be stimulated by DNA damage.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE image, using ab112411. (Stained with Coomassie Blue)

References

ab112411 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112411.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up