Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ96T88
    • SpeciesHuman
    • SequenceWNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNV CKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR
    • Molecular weight37 kDa including tags
    • Amino acids694 to 793

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112411 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityThis product is useful for Antibody Production and Protein Array
  • Applications

    Western blot

    ELISA

    Peptide Array

  • FormLiquid
  • Additional notesThis product is useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced.

General Info

  • Alternative names
    • Ac2-121
    • AL022808
    • E3 ubiquitin-protein ligase UHRF1
    • EC 6.3.2.-
    • FLJ21925
    • hNP95
    • hUHRF1
    • HuNp95
    • ICBP90
    • Inverted CCAAT box binding protein of 90 kDa
    • Inverted CCAAT box binding protein, 90-kD
    • Inverted CCAAT box-binding protein of 90 kDa
    • Liver regeneration-related protein LRRG126
    • MGC138707
    • NP95
    • Nuclear phosphoprotein, 95-KD
    • Nuclear protein 95
    • Nuclear zinc finger protein Np95
    • RING finger protein 106
    • RNF106
    • Transcription factor ICBP90
    • Ubiquitin like containing PHD and RING finger domains protein 1
    • Ubiquitin like PHD and RING finger domain containing protein 1
    • Ubiquitin-like PHD and RING finger domain-containing protein 1
    • Ubiquitin-like protein containing PHD and RING finger domains 1
    • Ubiquitin-like with PHD and ring finger domains 1
    • Ubiquitin-like, containing PHD and RING finger domains, 1
    • Ubiquitin-like-containing PHD and RING finger domains protein 1
    • UHRF1
    • UHRF1_HUMAN
    see all
  • FunctionPutative E3 ubiquitin-protein ligase. May participate in methylation-dependent transcriptional regulation. Binds to inverted 5'-CCAAT-3' box 2 in the TOP2A promoter, and activates TOP2A expression. Important for G1/S transition. May be involved in DNA repair and chromosomal stability.
  • Tissue specificityExpressed in thymus, bone marrow, testis, lung and heart. Overexpressed in breast cancer.
  • PathwayProtein modification; protein ubiquitination.
  • Sequence similaritiesContains 1 PHD-type zinc finger.
    Contains 2 RING-type zinc fingers.
    Contains 1 ubiquitin-like domain.
    Contains 1 YDG domain.
  • Developmental stageExpressed in fetal thymus, liver and kidney.
  • DomainThe RING finger is required for ubiquitin ligase activity.
    The YDG domain mediates the interaction with histone H3.
  • Post-translational
    modifications
    Phosphorylated on serine residues. Phosphorylation may enhance DNA-binding activity.
    Ubiquitinated; which leads to proteasomal degradation. Polyubiquitination may be stimulated by DNA damage.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human UHRF1 protein images

  • 12.5% SDS-PAGE image, using ab112411. (Stained with Coomassie Blue)

References for Recombinant Human UHRF1 protein (ab112411)

ab112411 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112411.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"