Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKHHHHHHASGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYD CGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTP KEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGA RKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAM S
    • Molecular weight
      23 kDa including tags
    • Amino acids
      26 to 216
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Mature form.

Specifications

Our Abpromise guarantee covers the use of ab184602 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    LC-MS/MS
  • Purity
    >90% by SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.6
    Constituent: Tris buffer

    0.4 µm filtered prior to lyophilization.

  • Reconstitution
    Add 200 µl of deionized water allow the lyophilized pellet dissolve completely.

General Info

  • Alternative names
    • ALCAN alpha
    • ALCAN-alpha
    • N2DL 2
    • N2DL-2
    • N2DL2
    • N2DL2_HUMAN
    • NKG2D ligand 2
    • NKG2D ligand 2 precursor
    • NKG2DL2
    • RAET1H
    • Retinoic acid early transcript 1 H
    • Retinoic acid early transcript 1H
    • UL16 binding protein 2
    • UL16-binding protein 2
    • ULBP2
    see all
  • Function
    Ligand for the NKG2D receptor, together with at least ULBP1 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP2 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface.
  • Tissue specificity
    Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues.
  • Sequence similarities
    Belongs to the MHC class I family.
  • Cellular localization
    Cell membrane. Secreted.
  • Information by UniProt

References

ab184602 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184602.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up