Recombinant Human ULBP2 protein (Fc Chimera) (ab185428)
Key features and details
- Expression system: Mammalian
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: Fc tag C-Terminus
- Suitable for: SDS-PAGE, HPLC
Description
-
Product name
Recombinant Human ULBP2 protein (Fc Chimera)
See all ULBP2 proteins and peptides -
Purity
> 95 % SDS-PAGE.
Determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Mammalian -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVS PLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARM SCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWEND KVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS -
Predicted molecular weight
22 kDa -
Amino acids
26 to 217 -
Tags
Fc tag C-Terminus -
Additional sequence information
Mature protein. C terminal FC tag.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab185428 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. Reconstitute for long term storage.
pH: 7.40
Constituent: 100% PBS
Lyophilized from an 0.2 µM filtered solution. -
ReconstitutionDissolve the lyophilized protein in 3X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
General Info
-
Alternative names
- ALCAN alpha
- ALCAN-alpha
- N2DL 2
see all -
Function
Ligand for the NKG2D receptor, together with at least ULBP1 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP2 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface. -
Tissue specificity
Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues. -
Sequence similarities
Belongs to the MHC class I family. -
Cellular localization
Cell membrane. Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab185428 has not yet been referenced specifically in any publications.