Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGPGWGPPRLDGFILTERLGSGTYATVYKAYAKKDTREVVAIKCVAKKS LNKASVENLLTEIEILKGIRHPHIVQLKDFQWDSDNIYLIMEFCAGGD
    • Amino acids
      1 to 98
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153260 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZP434C131
    • FLJ90566
    • Serine/threonine-protein kinase ULK3
    • Ulk3
    • ULK3_HUMAN
    • unc 51 like kinase 3 (C. elegans)
    • Unc-51-like kinase 3
    see all
  • Function
    Serine/threonine protein kinase which enhances GLI1 and GLI2 transcriptional activity and consequently positively regulates GLI-dependent SHH signaling. May exert this function by promoting GLI1 nuclear localization. Phosphorylates in vitro GLI2, as well as GLI1 and GLI3, although less efficiently.
  • Tissue specificity
    Widely expressed. Highest levels observed in fetal brain. In adult tissues, high levels in brain, liver and kidney, moderate levels in testis and adrenal gland and low levels in heart, lung, stomach, thymus, prostate and placenta. In the brain, highest expression in the hippocampus, high levels also detected in the cerebellum, olfactory bulb and optice nerve. In the central nervous system, lowest levels in the spinal cord.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. APG1/unc-51/ULK1 subfamily.
    Contains 2 MIT domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated in vitro.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab153260 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153260 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153260.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up