Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ASRAKLNLLCYLCVVAGHQEVATRLLHSPLFQLLIQHLRIAPNWDIRAKV AHVIGLLASHTAELQENTPVVETTSSIGIGILNCLVQHSTPVPRQCLVYV
    • Amino acids
      481 to 580
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162924 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp 434E1822
    • DKFZp434E1822
    • FAM 7 C 1
    • FAM7C1
    • FLJ 20574
    • FLJ20574
    • REC 01035
    • REC01035
    • Serine/threonine-protein kinase ULK4
    • ULK 4
    • ULK4
    • ULK4_HUMAN
    • Unc 51 like kinase 4
    • Unc 51 like kinase 4 (C. elegans)
    • Unc-51-like kinase 4
    see all
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. APG1/unc-51/ULK1 subfamily.
    Contains 5 HEAT repeats.
    Contains 1 protein kinase domain.
  • Domain
    The protein kinase domain is predicted to be catalytically inactive.
  • Information by UniProt

Images

  • ab162924 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162924 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162924.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up