Recombinant Human UNC13B protein (ab161024)

Overview

  • Product name
    Recombinant Human UNC13B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SKSNNWAPKYNETFHLLLGNEEGPESYELQICVKDYCFAREDRVLGLAVM PLRDVTAKGSCACWCPLGRKIHMDETGLTILRILSQRSNDEVAREFVKLK SESRSTEEGS
    • Amino acids
      1482 to 1591
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hmunc13
    • MGC133279
    • MGC133280
    • munc13
    • Munc13-2
    • Protein unc-13 homolog B
    • UN13B_HUMAN
    • unc-13 homolog B (C. elegans)
    • UNC13
    • Unc13b
    • Unc13h2
    see all
  • Function
    Plays a role in vesicle maturation during exocytosis as a target of the diacylglycerol second messenger pathway. Is involved in neurotransmitter release by acting in synaptic vesicle priming prior to vesicle fusion and participates in the activity-depending refilling of readily releasable vesicle pool (RRP). Essential for synaptic vesicle maturation in a subset of excitatory/glutamatergic but not inhibitory/GABA-mediated synapses.
  • Tissue specificity
    Expressed in kidney cortical epithelial cells and brain.
  • Sequence similarities
    Belongs to the unc-13 family.
    Contains 3 C2 domains.
    Contains 1 MHD1 (MUNC13 homology domain 1) domain.
    Contains 1 MHD2 (MUNC13 homology domain 2) domain.
    Contains 1 phorbol-ester/DAG-type zinc finger.
  • Domain
    The C2 domains are not involved in calcium-dependent phospholipid binding.
  • Cellular localization
    Cytoplasm. Membrane. Cell membrane. Cell junction > synapse. Localized to synapses. Translocated to the plasma membrane in response to phorbol ester binding.
  • Information by UniProt

Images

  • ab161024 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161024 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up