Overview

  • Product name
    Recombinant Human UNC5C protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IKVYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALSLKNQSLARQTDP SCTAFGSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMR
    • Amino acids
      498 to 597
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • homolog of C. elegans transmembrane receptor Unc5
    • Netrin receptor UNC5C
    • Protein unc 5 homolog C
    • Protein unc-5 homolog 3
    • Protein unc-5 homolog C
    • Unc 5 homolog 3
    • Unc 5 homolog C
    • Unc5 (C.elegans homolog) c
    • Unc5c
    • UNC5C_HUMAN
    • UNC5H3
    see all
  • Function
    Receptor for netrin required for axon guidance. Mediates axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding. Axon repulsion in growth cones may be caused by its association with DCC that may trigger signaling for repulsion. Also involved in corticospinal tract axon guidances independently of DCC. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand.
  • Tissue specificity
    Mainly expressed in brain. Also expressed in kidney. Not expressed in developing or adult lung.
  • Sequence similarities
    Belongs to the unc-5 family.
    Contains 1 death domain.
    Contains 1 Ig-like (immunoglobulin-like) domain.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 2 TSP type-1 domains.
    Contains 1 ZU5 domain.
  • Post-translational
    modifications
    Phosphorylated on different cytoplasmic tyrosine residues. Phosphorylation of Tyr-568 leads to an interaction with PTPN11 phosphatase, suggesting that its activity is regulated by phosphorylation/dephosphorylation. Tyrosine phosphorylation is netrin-dependent.
    Proteolytically cleaved by caspases during apoptosis. The cleavage does not take place when the receptor is associated with netrin ligand. Its cleavage by caspases is required to induce apoptosis.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160125 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160125 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up