Overview

  • Product name
    Recombinant Human UNC5D protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TDNGEALPESIPSAPGTLPHFIEEPDDAYIIKSNPIALRCKARPAMQIFF KCNGEWVHQNEHVSEETLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQ
    • Amino acids
      31 to 130
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165412 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ16019
    • KIAA1777
    • Netrin receptor UNC5D
    • Netrin receptor Unc5h4
    • PRO34692
    • Protein unc 5 homolog D
    • Unc 5 homolog 4
    • Unc 5 homolog D
    • Unc 5 homolog D (C. elegans)
    • UNC 5D
    • Unc5h4
    see all
  • Relevance
    UNC5D belongs to a family of netrin 1 receptors thought to mediate the chemorepulsive effect of netrin 1 on specific axons. On ligand binding UNC5D may mediate axon repulsion of neuronal growth cones in the developing nervous system.
  • Cellular localization
    Membrane; Single-pass type I membrane protein.

Images

  • ab165412 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165412 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165412.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up