Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVI LLTGYAHSSLPAELDSGACGGSSLNSEGNSGSGDSSSYDAPAGNSFLEDC ELSRQIGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSADRLIRLVVEE GLNQLPYKECMVTTPTGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCR SIRIGKILIQSDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGNTVIEA VKVLIEHGVQPSVIILLSLFSTPHGAKSIIQEFPEITILTTEVHPVAPTH FGQKYFGTD
    • Amino acids
      1 to 309
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165438 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp781E1243
    • FUR1
    • Gm774
    • MGC23937
    • RGD1564806
    • RP11-311P8.3
    • RP23-92C4.1
    • UPP
    • UPP_HUMAN
    • uprt
    • Uracil phosphoribosyltransferase homolog
    see all
  • Tissue specificity
    Highly expressed in leukocytes, liver, spleen and thymus, with lower expression in brain, lung and skeletal muscle.
  • Sequence similarities
    Belongs to the UPRTase family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab165438 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165438 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165438.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up