Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERL ELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK
    • Amino acids
      1 to 91
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Complex III subunit 6
    • Complex III subunit VIII
    • Cytochrome b c1 complex subunit 6
    • Cytochrome b c1 complex subunit 6 mitochondrial
    • Cytochrome c1 non heme 11 kDa protein
    • High protein , mitochondrial
    • MGC111572
    • Mitochondrial hinge protein
    • QCR 6
    • QCR6
    • Ubiquinol cytochrome c reductase complex 11 kDa protein
    • Ubiquinol cytochrome c reductase complex 11 kDa protein mitochondrial
    • Ubiquinol cytochrome c reductase complex III subunit VIII
    • Ubiquinol cytochrome c reductase hinge protein
    • ubiquinol-cytochrome c reductase hinge protein
    • UQCR8
    see all
  • Relevance
    UQRCH is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. It may play a role in electron transfer between cytochromes c1 and c.
  • Cellular localization
    Mitochondrial. Mitochondrion inner membrane.

Images

  • ab159788 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159788 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up