Recombinant Human Uridine Phosphorylase 1 protein (ab172847)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQRKLKVTSLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDL NKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDK QAYLEAAYAAGVRNI EMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQR LVSYFIKKKLSKA
    • Molecular weight
      21 kDa including tags
    • Amino acids
      1 to 173
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab172847 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It is supplied as an 0.2 µM filtered solution.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.24% Tris, 1.17% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • UDRPASE
    • UP
    • UPASE
    • UPase 1
    • UPP
    • Upp1
    • UPP1_HUMAN
    • UrdPase 1
    • Uridine phosphorylase 1
    see all
  • Function
    Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
  • Pathway
    Pyrimidine metabolism; UMP biosynthesis via salvage pathway; uracil from uridine (phosphorylase route): step 1/1.
  • Sequence similarities
    Belongs to the PNP/UDP phosphorylase family.
  • Information by UniProt

References

ab172847 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up