Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAAPLSVEVEFGGGAELLFDGIKKHRVTLP GQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLG ELDYQLQDQDSVLFISTLHGG
    • Molecular weight
      14 kDa including tags
    • Amino acids
      1 to 101
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab105598 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 2900073H19Rik
    • C9orf74
    • Chromosome 9 open reading frame 74
    • MGC2668
    • RGD1306599
    • RP11 339B21.4
    • RP23-443G7.1
    • Ubiquitin related modifier 1
    • Ubiquitin related modifier 1 homolog
    • Ubiquitin-related modifier 1 homolog
    • Urm 1
    • URM1
    • URM1_HUMAN
    see all
  • Function
    Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. May also act as an ubiquitin-like protein that is covalently conjugated to other proteins; the relevance of such function is however unclear in vivo.
  • Pathway
    tRNA modification; 5-methoxycarbonylmethyl-2-thiouridine-tRNA biosynthesis.
  • Sequence similarities
    Belongs to the URM1 family.
  • Post-translational
    modifications
    C-terminal thiocarboxylation occurs in 2 steps, it is first acyl-adenylated (-COAMP) via the hesA/moeB/thiF part of MOCS3, then thiocarboxylated (-COSH) via the rhodanese domain of MOCS3.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab105598.

References

ab105598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up