Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BTM9
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAAPLSVEVEFGGGAELLFDGIKKHRVTLP GQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLG ELDYQLQDQDSVLFISTLHGG
    • Molecular weight14 kDa including tags
    • Amino acids1 to 101
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab105598 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 2900073H19Rik
    • C9orf74
    • Chromosome 9 open reading frame 74
    • MGC2668
    • RGD1306599
    • RP11 339B21.4
    • RP23-443G7.1
    • Ubiquitin related modifier 1
    • Ubiquitin related modifier 1 homolog
    • Ubiquitin-related modifier 1 homolog
    • Urm 1
    • URM1
    • URM1_HUMAN
    see all
  • FunctionActs as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. May also act as an ubiquitin-like protein that is covalently conjugated to other proteins; the relevance of such function is however unclear in vivo.
  • PathwaytRNA modification; 5-methoxycarbonylmethyl-2-thiouridine-tRNA biosynthesis.
  • Sequence similaritiesBelongs to the URM1 family.
  • Post-translational
    modifications
    C-terminal thiocarboxylation occurs in 2 steps, it is first acyl-adenylated (-COAMP) via the hesA/moeB/thiF part of MOCS3, then thiocarboxylated (-COSH) via the rhodanese domain of MOCS3.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Urm1 protein images

  • 15% SDS-PAGE analysis of 3µg ab105598.

References for Recombinant Human Urm1 protein (ab105598)

ab105598 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"