Recombinant Human Urokinase protein (ab159135)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEID KSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLG
    • Amino acids
      16 to 115
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159135 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATF
    • ATF uPA
    • BDPLT5
    • Plasminogen activator
    • Plasminogen activator urinary
    • Plasminogen activator urokinase
    • PLAU
    • QPD
    • u PA
    • U plasminogen activator
    • u-PA
    • U-plasminogen activator
    • uPA
    • URK
    • UROK_HUMAN
    • Urokinase plasminogen activator
    • Urokinase type plasminogen activator
    • Urokinase type plasminogen activator precursor
    • Urokinase-type plasminogen activator chain B
    see all
  • Function
    Specifically cleave the zymogen plasminogen to form the active enzyme plasmin.
  • Tissue specificity
    Expressed in the prostate gland and prostate cancers.
  • Sequence similarities
    Belongs to the peptidase S1 family.
    Contains 1 EGF-like domain.
    Contains 1 kringle domain.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications
    Phosphorylation of Ser-158 and Ser-323 abolishes proadhesive ability but does not interfere with receptor binding.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab159135 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159135 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159135.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up