Recombinant Human Uroplakin Ib protein (ab159771)

Overview

  • Product name
    Recombinant Human Uroplakin Ib protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENN DADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNR
    • Amino acids
      131 to 228
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Tetraspanin-20
    • Tspan-20
    • TSPAN20
    • UP1b
    • UPIb
    • UPK1B
    • UPK1B_HUMAN
    • Uroplakin Ib
    • Uroplakin-1b
    see all
  • Function
    Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in normal bladder epithelial physiology, possibly in regulating membrane permeability of superficial umbrella cells or in stabilizing the apical membrane through AUM/cytoskeletal interactions.
  • Tissue specificity
    Bladder epithelium.
  • Sequence similarities
    Belongs to the tetraspanin (TM4SF) family.
  • Post-translational
    modifications
    N-glycosylated with high-mannose oligosaccharides.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159771 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159771 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up