Recombinant Human Uroplakin III protein (ab115705)

Overview

  • Product name
    Recombinant Human Uroplakin III protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMVNLQPQLASVTFATNNPTLTTVALE KPLCMFDSKEALTGTHEVYLYVLVDSAISRNASVQDSTNTPLGSTFLQTE GGRTGPYKAVAFDLIPCSDLPSLDAIGDVSKASQILNAYLVRVGANGTCL WDPNFQGLCNPPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTP YSTIDTWPGRRSGG
    • Molecular weight
      23 kDa including tags
    • Amino acids
      19 to 207
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115705 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab115705 is purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • MGC119178
    • OTTHUMP00000028951
    • UP III
    • UP3a
    • UPIII
    • UPIIIA
    • UPK 3
    • UPK 3A
    • UPK3
    • UPK3A
    • UPK3A_HUMAN
    • Uroplakin 3A
    • Uroplakin III
    • Uroplakin-3a
    • Uroplakin3A
    • UroplakinIII
    see all
  • Function
    Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells. It also contributes to the formation of urothelial glycocalyx which may play an important role in preventing bacterial adherence.
  • Tissue specificity
    Expressed in ureter.
  • Involvement in disease
    Defects in UPK3A are a cause of renal adysplasia (RADYS) [MIM:191830]; also known as renal agenesis or renal aplasia. Renal agenesis refers to the absence of one (unilateral) or both (bilateral) kidneys at birth. Bilateral renal agenesis belongs to a group of perinatally lethal renal diseases, including severe bilateral renal dysplasia, unilateral renal agenesis with contralateral dysplasia and severe obstructive uropathy.
  • Sequence similarities
    Belongs to the uroplakin-3 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Heterodimer formation with UPK1B is a prerequisite to exit out of the endoplasmic reticulum (ER).
  • Information by UniProt

Recombinant Human Uroplakin III protein images

  • 15% SDS-PAGE showing ab115705 at approximately 23.1kDa (3µg).

References for Recombinant Human Uroplakin III protein (ab115705)

ab115705 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab115705.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up