Recombinant Human Uroplakin III protein (ab115705)

Overview

  • Product name
    Recombinant Human Uroplakin III protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMVNLQPQLASVTFATNNPTLTTVALE KPLCMFDSKEALTGTHEVYLYVLVDSAISRNASVQDSTNTPLGSTFLQTE GGRTGPYKAVAFDLIPCSDLPSLDAIGDVSKASQILNAYLVRVGANGTCL WDPNFQGLCNPPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTP YSTIDTWPGRRSGG
    • Molecular weight
      23 kDa including tags
    • Amino acids
      19 to 207
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115705 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab115705 is purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • MGC119178
    • OTTHUMP00000028951
    • UP III
    • UP3a
    • UPIII
    • UPIIIA
    • UPK 3
    • UPK 3A
    • UPK3
    • UPK3A
    • UPK3A_HUMAN
    • Uroplakin 3A
    • Uroplakin III
    • Uroplakin-3a
    • Uroplakin3A
    • UroplakinIII
    see all
  • Function
    Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells. It also contributes to the formation of urothelial glycocalyx which may play an important role in preventing bacterial adherence.
  • Tissue specificity
    Expressed in ureter.
  • Involvement in disease
    Defects in UPK3A are a cause of renal adysplasia (RADYS) [MIM:191830]; also known as renal agenesis or renal aplasia. Renal agenesis refers to the absence of one (unilateral) or both (bilateral) kidneys at birth. Bilateral renal agenesis belongs to a group of perinatally lethal renal diseases, including severe bilateral renal dysplasia, unilateral renal agenesis with contralateral dysplasia and severe obstructive uropathy.
  • Sequence similarities
    Belongs to the uroplakin-3 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Heterodimer formation with UPK1B is a prerequisite to exit out of the endoplasmic reticulum (ER).
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab115705 at approximately 23.1kDa (3µg).

References

ab115705 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab115705.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up