Recombinant Human Uroplakin IIIB protein (ab164287)

Overview

  • Product name
    Recombinant Human Uroplakin IIIB protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGLPWGQPHLGLQMLLLALNCLRPSLSLGEWGSWMDASSQTQGAGGPAGV IGPWAPAPLRLGEAAPGTPTPVSVAHLLSPVATELVPYTPQITAWDLEGK VTATTFSLEQPRCVFDGLASASDTVWLVVAFSNASRGFQNPETLADIPAS PQLLTDGHYMTLPLSPDQLPCGDPMAGSGGAPVLRVGHDHGCHQQPFCNA PLPGPGPYREDPRIHRHLARAAKWQHDRHYLHPLFSGRPPTLGLLGSLYH ALLQPVVAGGGPGAAADRLLHGQALHDPPHPTQRGRHTAGGLQAWPGPPP QPQPLAWPLCMGLGEMGRRE
    • Amino acids
      1 to 320
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164287 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ32198
    • MGC10902
    • p35
    • UP3b
    • UPIIIb
    • UPK3B
    • UPK3B_HUMAN
    • uroplakin 3B
    • Uroplakin IIIb
    • Uroplakin-3b
    see all
  • Function
    Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells. It also contributes to the formation of urothelial glycocalyx which may play an important role in preventing bacterial adherence.
  • Sequence similarities
    Belongs to the uroplakin-3 family.
  • Cellular localization
    Cell membrane. Heterodimer formation with UPK1B is a prerequisite to exit out of the endoplasmic reticulum.
  • Information by UniProt

Images

  • ab164287 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164287 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164287.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up