Overview

  • Product name
    Recombinant Human URP2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAGMKTASGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIV EQINRKQDWSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPV ILRLPNRRALRLRASFSQPLFQAVAAICRLLSIRHPEELSLLRAPEKKEK KKKEKEPEEELYDLSKVVLAGGVAPALFRGMPAHFSDSAQTEACYHMLSR PQPPPDPLLLQRLPRPSSLSDKTQLHSRWLDSSRCLMQQGIKAGDALWLR FKYYSFFDLDPKTDPVRLTQLYEQARWDLLLEEIDCTEEEMMVFAALQYH INKLSQSGEVGEPAGTDPGLDDLDVALSNLEVKLEGSAPTDVLDSLTTIP ELKDHLRIFRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNL KGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRL ASKGRTMADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPY GLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQLRFIQAWQSLPDFG ISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNW DIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDE DLFLQLTGGHEAF
    • Molecular weight
      99 kDa including tags
    • Amino acids
      1 to 663

Specifications

Our Abpromise guarantee covers the use of ab112425 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • Fermitin family homolog 3
    • Fermitin family member 3
    • FERMT3
    • Kind3
    • Kindlin 3
    • Kindlin-3
    • Kindlin3
    • MGC10966
    • MIG 2
    • MIG2 like protein
    • MIG2-like protein
    • MIG2B
    • Unc 112 related protein 2
    • Unc-112-related protein 2
    • UNC112C
    • URP2_HUMAN
    • URP2SF
    see all
  • Function
    Plays a central role in cell adhesion in hematopoietic cells. Acts by activating the integrin beta-1-3 (ITGB1, ITGB2 and ITGB3). Required for integrin-mediated platelet adhesion and leukocyte adhesion to endothelial cells. Required for activation of integrin beta-2 (ITGB2) in polymorphonuclear granulocytes (PMNs).
    Isoform 2 may act as a repressor of NF-kappa-B and apoptosis.
  • Tissue specificity
    Highly expressed in lymph node. Expressed in thymus, spleen and leukocytes. Weakly expressed in placenta, small intestine, stomach, testis and lung. Overexpressed in B-cell malignancies.
  • Involvement in disease
    Defects in FERMT3 are the cause of leukocyte adhesion deficiency type 3 (LAD3) [MIM:612840]; also called leukocyte adhesion deficiency 1 variant (LAD1v). LAD3 is a rare syndrome characterized by infections without pus formation in the presence of a leukocytosis combined with a Glanzmann-type bleeding disorder, resulting from a hematopoietic defect in integrin activation. Symptoms arise from an inability to activate the integrins expressed on hematopoietic cells, including platelets and leukocytes.
  • Sequence similarities
    Belongs to the kindlin family.
    Contains 1 FERM domain.
    Contains 1 PH domain.
  • Domain
    The FERM domain is not correctly detected by PROSITE or Pfam techniques because it contains the insertion of a PH domain.
  • Cellular localization
    Cell projection > podosome. Present in the F-actin surrounding ring structure of podosomes, which are specialized adhesion structures of hematopoietic cells.
  • Information by UniProt

Recombinant Human URP2 protein images

  • ab112425 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human URP2 protein (ab112425)

ab112425 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112425.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up