Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHA SKPASEVINEYSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTAR ERVPATKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKRTGVAGSQPVS EKQLAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQT LSHSLKMADQNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMIL FIRIMPKLK
    • Molecular weight
      43 kDa including tags
    • Amino acids
      1 to 259
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab188719 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Typical enzyme concentration to support conjugation in vitro is 100 nM-1 μM depending on conditions.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .
    95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie® Blue stain.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 1.19% HEPES, 10% Glycerol, 0.02% DTT, 0.29% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 2010315L10Rik
    • 5730403H22Rik
    • AV002165
    • D12
    • Ed2
    • Embryonic development factor 2
    • MDS032
    • P31
    • Protein D12
    • Protein p31
    • Putative MAPK activating protein PM26
    • Putative MAPK-activating protein PM26
    • Q-snare
    • RGD1306660
    • SLT1
    • SNARE-like tail-anchored protein 1 homolog
    • Unconventional SNARE in the ER 1 homolog
    • Unconventional SNARE in the ER 1 homolog (S. cerevisiae)
    • Use1
    • USE1 like protein
    • Use1 unconventional SNARE in the ER 1 homolog (S. cerevisiae)
    • USE1-like protein
    • USE1_HUMAN
    • USE1L
    • Vesicle transport protein USE1
    see all
  • Function
    SNARE that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER.
  • Sequence similarities
    Belongs to the USE1 family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

References

ab188719 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188719.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up