Recombinant human USP1 + UAF1 protein (Active) (ab188739)

Overview

  • Product name
    Recombinant human USP1 + UAF1 protein (Active)
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf21 cells
  • Amino Acid Sequence 1
    • Accession
    • Species
      Human
    • Sequence
      MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKAS EYRASEIDQVVPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLY FCPGFKSGVKHLFNIISRKKEALKDEANQKDKGNCKEDSLASYELICSLQ SLIISVEQLQASFLLNPEKYTDELATQPRRLLNTLRELNPMYEGYLQHDA QEVLQCILGNIQETCQLLKKEEVKNVAELPTKVEEIPHPKEEMNGINSIE MDSMRHSEDFKEKLPKGNGKRKSDTEFGNMKKKVKLSKEHQSLEENQRQT RSKRKATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPS ILSKFCSLGKITTNQGVKGQSKENECDPEEDLGKCESDNTTNGCGLESPG NTVTPVNVNEVKPINKGEEQIGFELVEKLFQGQLVLRTRCLECESLTERR EDFQDISVPVQEDELSKVEESSEISPEPKTEMKTLRWAISQFASVERIVG EDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGLEFDCYGGGLS KINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKV TDLNSLELDKGNFVVDQMCEIGKPEPLNEEEARGVVENYNDEEVSIRVGG NTQPSKVLNKKNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRN SETSDTTGTHESDRNKESSDQTGINISGFENKISYVVQSLKEYEGKWLLF DDSEVKVTEEKDFLNSLSPSTSPTSTPYLLFYKKL
    • Molecular weight
      89 kDa including tags
    • Amino acids
      1 to 785
    • Modifications
      mutated G670 A + G671 A
    • Tags
      His tag C-Terminus
    • Additional sequence information
      The assembled complex contains 25 µg each of USP1 and WDR48, resulting in a 1:1.2 stoichiometry.
    Amino Acid Sequence 2
    • Accession
    • Species
      Human
    • Sequence
      MAAHHRQNTAGRRKVQVSYVIRDEVEKYNRNGVNALQLDPALNRLFTAGR DSIIRIWSVNQHKQDPYIASMEHHTDWVNDIVLCCNGKTLISASSDTTVK VWNAHKGFCMSTLRTHKDYVKALAYAKDKELVASAGLDRQIFLWDVNTLT ALTASNNTVTTSSLSGNKDSIYSLAMNQLGTIIVSGSTEKVLRVWDPRTC AKLMKLKGHTDNVKALLLNRDGTQCLSGSSDGTIRLWSLGQQRCIATYRV HDEGVWALQVNDAFTHVYSGGRDRKIYCTDLRNPDIRVLICEEKAPVLKM ELDRSADPPPAIWVATTKSTVNKWTLKGIHNFRASGDYDNDCTNPITPLC TQPDQVIKGGASIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGK VDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF SSPDGSDPKLNLGGLLLQALLEYWPRTHVNPMDEEENEVNHVNGEQENRV QKGNGYFQVPPHTPVIFGEAGGRTLFRLLCRDSGGETESMLLNETVPQWV IDITVDKNMPKFNKIPFYLQPHASSGAKTLKKDRLSASDMLQVRKVMEHV YEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDP NMDLRTVKHFIWKSGGDLTLHYRQKST
    • Molecular weight
      89 kDa including tags
    • Amino acids
      1 to 667
    • Tags
      His tag C-Terminus
    • Additional sequence information
      The assembled complex contains 25 µg each of USP1 and WDR48, resulting in a 1:1.2 stoichiometry.

Specifications

Our Abpromise guarantee covers the use of ab188739 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Typical enzyme concentration for in vitro deconjugation reactions ranges from 0.01-0.5 µM depending on conditions and substrate.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 1.19% HEPES, 0.58% Sodium chloride, 10% Glycerol, 0.03% TCEP

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

References

ab188739 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188739.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up