Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KLIKNIEYPVDLEISKELLSPGVKNKNFKCHRTYRLFAVVYHHGNSATGG HYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPTAERTAYLLYYRRVDL
    • Amino acids
      699 to 797
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Deubiquitinating enzyme 10
    • KIAA0190
    • MGC124997
    • MGC2621
    • Ubiquitin carboxyl terminal hydrolase 10
    • Ubiquitin carboxyl-terminal hydrolase 10
    • Ubiquitin specific peptidase 10
    • Ubiquitin specific processing protease 10
    • Ubiquitin specific protease 10
    • Ubiquitin thioesterase 10
    • Ubiquitin thiolesterase 10
    • Ubiquitin-specific-processing protease 10
    • UBP10_HUMAN
    • UBPO
    • USP 10
    • USP10
    see all
  • Function
    Hydrolase that can remove conjugated ubiquitin from target proteins such as p53/TP53, SNX3 and CFTR. Acts as an essential regulator of p53/TP53 stability: in unstressed cells, specifically deubiquitinates p53/TP53 in the cytoplasm, leading to counteract MDM2 action and stabilize p53/TP53. Following DNA damage, translocates to the nucleus and deubiquitinates p53/TP53, leading to regulate the p53/TP53-dependent DNA damage response. Does not deubiquitinate MDM2. Deubiquitinates CFTR in early endosomes, enhancing its endocytic recycling.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the peptidase C19 family. USP10 subfamily.
  • Post-translational
    modifications
    Phosphorylated by ATM following DNA damage, leading to stablization and translocation it to the nucleus.
  • Cellular localization
    Cytoplasm. Nucleus. Early endosome. Cytoplasmic in normal conditions. After DNA damage, translocates to the nucleus following phosphorylation by ATM.
  • Information by UniProt

Images

  • ab152951 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up