Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGS LDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDE
    • Amino acids
      201 to 300
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159977 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Deubiquitinating enzyme 11
    • Ubiquitin carboxyl-terminal hydrolase 11
    • Ubiquitin carboxyl-terminal hydrolase X linked
    • ubiquitin specific peptidase 11
    • Ubiquitin specific protease 11
    • Ubiquitin thiolesterase 11
    • Ubiquitin-specific-processing protease 11
    • UBP11_HUMAN
    • UHX1
    • USP11
    see all
  • Function
    Protease that can remove conjugated ubiquitin from target proteins and polyubiquitin chains. Inhibits the degradation of target proteins by the proteasome. Plays a role in the regulation of pathways leading to NF-kappa-B activation. Plays a role in the regulation of DNA repair after double-stranded DNA breaks.
  • Sequence similarities
    Belongs to the peptidase C19 family.
    Contains 1 DUSP domain.
  • Cellular localization
    Nucleus. Cytoplasm. Predominantly nuclear. Associates with chromatin.
  • Information by UniProt

Images

  • ab159977 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159977 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159977.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up