Overview

  • Product name
    Recombinant Human USP13 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQRRGALFGMPGGSGGRKMAAGDIGELLVPHMPTIRVPRSGDRVYKNECA FSYDSPNSEGGLYVCMNTFLAFGREHVERHFRKTGQSVYMHLKRHVREKV RGASGGALPKRRNSKIFLDLDTDDDLNSDDYEYEDEAKLVIFPDHYEIAL PNIEELPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDN GVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSGGNGHALEHYR DMGYPLAVKLGTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDMLHMHG PENGLQDNDIKLRVSEWEVIQESGTKLKPMYGPGYTGLKNLGNSCYLSSV MQAIFSIPEFQRAYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYS KPPVKSELIEQVMKEEHKPQQNGISPRMFKAFVSKSHPEFSSNRQQDAQE FFLHLVNLVERNRIGSENPSDVFRFLVEERIQCCQTRKVRYAERVDYLMQ LPVAMEAATNKDELIAYELTRREAEANRRPLPELVRAKIPFSACLQAFSE PENVDGFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKFD VSIDMPDLLDINHLRARGLQPGEEELPDISPPIVIPDDSKDCLMNQLIDP SDIDESSVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFA EPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQAL RATNNNLERALDWIFSHPEFEEDSDFVIEMENNANANIISEAKPEGPRVK DGSGTYELFAFISHMGTSTMSGHYICHIKKEGRWVIYNDHKVCASERPPK DLGYMYFYRRIPS
    • Amino acids
      1 to 863
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160279 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Deubiquitinating enzyme 13
    • Isopeptidase T 3
    • Isopeptidase T-3
    • Isopeptidase T3
    • ISOT 3
    • ISOT-3
    • ISOT3
    • Ubiquitin carboxyl terminal hydrolase 13
    • Ubiquitin carboxyl-terminal hydrolase 13
    • Ubiquitin specific peptidase 13
    • Ubiquitin specific peptidase 13 (isopeptidase T3)
    • Ubiquitin specific processing protease 13
    • Ubiquitin specific protease 13
    • Ubiquitin thioesterase 13
    • Ubiquitin thiolesterase 13
    • Ubiquitin-specific-processing protease 13
    • UBP13
    • UBP13_HUMAN
    • USP 13
    • USP13
    see all
  • Tissue specificity
    Highly expressed in ovary and testes.
  • Sequence similarities
    Belongs to the peptidase C19 family.
    Contains 2 UBA domains.
    Contains 1 UBP-type zinc finger.
  • Information by UniProt

Images

  • ab160279 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160279 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160279.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up