Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKG GTLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASA MELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQ YITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDA NECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVE FETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITK QSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFP LMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVK YEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKF DDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
    • Molecular weight
      56 kDa
    • Amino acids
      1 to 494

Specifications

Our Abpromise guarantee covers the use of ab188696 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The activity of ab188696 was measured at 2.0 RFU/min/μg using an enzyme concentration of 18 μM and a Ub-­AMC concentration of 4 μM in 100 mM HEPES, pH 8.5, 10 mM DTT, and 5% Glycerol at 25°C. USP14 activity is greatly stimulated in the presence of 19S proteasome.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .
    Purified under reducing conditions and visualized by Coomassie Blue.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 1.19% HEPES, 0.29% Sodium chloride, 0.03% EDTA, 0.08% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Deubiquitinating enzyme 14
    • TGT
    • tRNA guanine transglycosylase
    • tRNA guanine transglycosylase 60 kD subunit
    • Ubiquitin carboxyl terminal hydrolase 14
    • Ubiquitin carboxyl-terminal hydrolase 14
    • Ubiquitin specific peptidase 14
    • Ubiquitin specific processing protease 14
    • Ubiquitin specific protease 14
    • Ubiquitin thiolesterase 14
    • Ubiquitin-specific-processing protease 14
    • UBP14_HUMAN
    • USP 14
    • USP14
    see all
  • Function
    Proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins. Ensures the regeneration of ubiquitin at the proteasome. Is a reversibly associated subunit of the proteasome and a large fraction of proteasome-free protein exists within the cell. Required for the degradation of the chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. Serves also as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under the non-stressed condition by inhibiting the degradation of unfolded endoplasmic reticulum proteins via interaction with ERN1. Indispensable for synaptic development and function at neuromuscular junctions (NMJs).
  • Sequence similarities
    Belongs to the peptidase C19 family. USP14/UBP6 subfamily.
    Contains 1 ubiquitin-like domain.
  • Cellular localization
    Cytoplasm. Cell membrane.
  • Information by UniProt

References

ab188696 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188696.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up