Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAEGGAADLDTQRSDIATLLKTSLRKG DTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQ SLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHC KVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKET RLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTP KKPLEQSC
    • Molecular weight
      30 kDa including tags
    • Amino acids
      1 to 235
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167838 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab167838 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • Deubiquitinating enzyme
    • Deubiquitinating enzyme 15
    • EC 3 1 2 15
    • KIAA0529
    • MGC131982
    • MGC149838
    • MGC74854
    • Ubiquitin Carboxy terminal Hydrolase 15
    • Ubiquitin carboxyl-terminal hydrolase 15
    • Ubiquitin specific peptidase 15
    • Ubiquitin specific processing protease 15
    • Ubiquitin Specific Protease 15
    • Ubiquitin thioesterase 15
    • Ubiquitin thiolesterase 15
    • Ubiquitin-specific-processing protease 15
    • UBP 15
    • UBP15
    • UBP15_HUMAN
    • Unph 2
    • UNPH 4
    • Unph-2
    • Unph2
    • Unph4
    • USP 15
    • Usp15
    see all
  • Function
    Protease that degrades 'Lys-48'-linked polyubiquitin chains. Protects target proteins against proteasomal degradation. Protects APC and human papillomavirus type 16 protein E6 against degradation via the ubiquitin proteasome pathway.
  • Tissue specificity
    Expressed in skeletal muscle, kidney, heart, placenta, liver, thymus, lung, and ovary, with little or no expression in other tissues.
  • Sequence similarities
    Belongs to the peptidase C19 family.
    Contains 1 DUSP domain.
  • Post-translational
    modifications
    Phosphorylated. Phosphorylation protects against ubiquitination and subsequent degradation by the proteasome.
    Ubiquitinated, leading to degradation by the proteasome.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab167838 (3 µg).

References

ab167838 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167838.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up