Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FSASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVH YGHYTALCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQEPPRCL
    • Amino acids
      466 to 565
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162053 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Deubiquitinating enzyme 21
    • deubiquitinating enzyme 23
    • EC 3.1.2.15
    • ESTM28
    • MGC3394
    • NEDD8-specific protease
    • Ubiquitin carboxyl terminal hydrolase 21
    • ubiquitin carboxyl terminal hydrolase 23
    • Ubiquitin carboxyl-terminal hydrolase 21
    • ubiquitin specific peptidase 21
    • Ubiquitin specific processing protease 21
    • ubiquitin specific protease 16
    • ubiquitin specific protease 21
    • ubiquitin specific protease 23
    • Ubiquitin thioesterase 21
    • Ubiquitin thiolesterase 21
    • ubiquitin thiolesterase 23
    • ubiquitin-specific protease 23, formerly
    • Ubiquitin-specific-processing protease 21
    • UBP21_HUMAN
    • USP16
    • Usp21
    • USP23
    • USP23, formerly
    • W53272
    see all
  • Function
    Deubiquitinates histone H2A, a specific tag for epigenetic transcriptional repression, thereby acting as a coactivator. Deubiquitination of histone H2A releaves the repression of di- and trimethylation of histone H3 at 'Lys-4', resulting in regulation of transcriptional initiation. Regulates gene expression via histone H2A deubiquitination (By similarity). Also capable of removing NEDD8 from NEDD8 conjugates but has no effect on Sentrin-1 conjugates.
  • Tissue specificity
    Highly expressed in heart, pancreas and skeletal muscle. Also expressed in brain, placenta, liver and kidney, and at very low level in lung.
  • Sequence similarities
    Belongs to the peptidase C19 family. USP21 subfamily.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162053 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162053 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162053.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up