Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VMNELIIPCIHLIINNDISKDDLDAIEVMRNHWCSYLGQDIAENLQLCLG EFLPRLLDPSAEIIVLKEPPTIRPNSPYDLCSRFAAVMESIQGVSTVTVK
    • Amino acids
      978 to 1077
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Deubiquitinating enzyme 28
    • KIAA1515
    • Ubiquitin carboxyl terminal hydrolase 28
    • Ubiquitin carboxyl-terminal hydrolase 28
    • ubiquitin carboxyl-terminal hydrolase 28 variant 1
    • Ubiquitin specific peptidase 28
    • Ubiquitin specific processing protease 28
    • Ubiquitin specific protease 28
    • Ubiquitin thioesterase 28
    • Ubiquitin thiolesterase 28
    • Ubiquitin-specific-processing protease 28
    • UBP28_HUMAN
    • USP 28
    • USP28
    • USP28 protein
    see all
  • Function
    Deubiquitinase involved in DNA damage response checkpoint and MYC proto-oncogene stability. Involved in DNA damage induced apoptosis by specifically deubiquitinating proteins of the DNA damage pathway such as CLSPN. Also involved in G2 DNA damage checkpoint, by deubiquitinating CLSPN, and preventing its degradation by the anaphase promoting complex/cyclosome (APC/C). In contrast, it does not deubiquitinate PLK1. Specifically deubiquitinates MYC in the nucleoplasm, leading to prevent MYC degradation by the proteasome: acts by specifically interacting with isoform 1 of FBXW7 (FBW7alpha) in the nucleoplasm and counteracting ubiquitination of MYC by the SCF(FBW7) complex. In contrast, it does not interact with isoform 4 of FBXW7 (FBW7gamma) in the nucleolus, allowing MYC degradation and explaining the selective MYC degradation in the nucleolus.
  • Sequence similarities
    Belongs to the peptidase C19 family. USP28 subfamily.
    Contains 1 UIM (ubiquitin-interacting motif) repeat.
  • Post-translational
    modifications
    Degradaded upon nickel ion level or hypoxia exposure.
    Phosphorylated upon DNA damage at Ser-67 and Ser-714, by ATM or ATR.
  • Cellular localization
    Nucleus > nucleoplasm.
  • Information by UniProt

Images

  • ab163619 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163619 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up