Overview

  • Product name
    Recombinant Human USP44 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLAMDTCKHVGQLQLAQDHSSLNPQKWHCVDCNTTESIWACLSCSHVACG RYIEEHALKHFQESSHPVALEVNEMYVFCYLCDDYVLNDNATGDLKLLRR TLSAIKSQNYHCTTRSGRFLRSMGTGDDSYFLHDGAQSLLQSEDQLYTAL WHRRRILMGKIFRTWFEQSPIGRKKQEEPFQEKIVVKREVKKRRQELEYQ VKAELESMPPRKSLRLQGLAQSTIIEIVSVQVPAQTPASPAKDKVLSTSE NEISQKVSDSSVKRRPIVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQC FLKLDLNQWLAMTASEKTRSCKHPPVTDTVVYQMNECQEKDTGFVCSRQS SLSSGLSGGASKGRKMELIQPKEPTSQYISLCHELHTLFQVMWSGKWALV SPFAMLHSVWRLIPAFRGYAQQDAQEFLCELLDKIQRELETTGTSLPALI PTSQRKLIKQVLNVVNNIFHGQLLSQVTCLACDNKSNTIEPFWDLSLEFP ERYQCSGKDIASQPCLVTEMLAKFTETEALEGKIYVCDQCNSKRRRFSSK PVVLTEAQKQLMICHLPQVLRLHLKRFRWSGRNNREKIGVHVGFEEILNM EPYCCRETLKSLRPECFIYDLSAVVMHHGKGFGSGHYTAYCYNSEGGFWV HCNDSKLSMCTMDEVCKAQAYILFYTQRVTENGHSKLLPPELLLGSQHPN EDADTSSNEILS
    • Amino acids
      1 to 712
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164494 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Deubiquitinating enzyme 44
    • E430004F17Rik
    • Ubiquitin carboxyl-terminal hydrolase 44
    • ubiquitin specific peptidase 44
    • Ubiquitin thiolesterase 44
    • Ubiquitin-specific-processing protease 44
    • UBP44_HUMAN
    • USP44
    see all
  • Function
    Deubiquitinase that plays a key role in the spindle checkpoint by preventing premature anaphase onset. Acts by specifically mediating deubiquitination of CDC20, a negative regulator of the anaphase promoting complex/cyclosome (APC/C). Deubiquitination of CDC20 leads to stabilize the MAD2L1-CDC20-APC/C ternary complex (also named mitotic checkpoint), thereby preventing premature activation of the APC/C.
  • Tissue specificity
    Expressed in testis.
  • Sequence similarities
    Belongs to the peptidase C19 family. USP44 subfamily.
    Contains 1 UBP-type zinc finger.
  • Developmental stage
    Elevated in mitosis; levels increase in mitotic cells and rapidly decrease once cells have completed chromosome attachment and exit from mitosis.
  • Post-translational
    modifications
    Phosphorylated.
    Ubiquitinated; undergoes both 'Lys-48'- and 'Lys-63'-linked polyubiquitination.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab164494 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164494 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164494.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up