Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RFKYMEQLHRYTKLSYRVVFPLELRLFNTSSDAVNLDRMYDLVAVVVHCG SGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSES GYILFYQSR
    • Amino acids
      257 to 365
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Deubiquitinating enzyme 46
    • FLJ11850
    • FLJ12552
    • FLJ14283
    • FLJ39393
    • Ubiquitin carboxyl terminal hydrolase 46
    • Ubiquitin carboxyl-terminal hydrolase 46
    • Ubiquitin specific peptidase 46
    • Ubiquitin specific processing protease 46
    • Ubiquitin specific protease 46
    • Ubiquitin thioesterase 46
    • Ubiquitin thiolesterase 46
    • Ubiquitin-specific-processing protease 46
    • UBP46_HUMAN
    • USP46
    see all
  • Function
    Deubiquitinating enzyme that plays a role in behavior, possibly by regulating GABA action. May act by mediating the deubiquitination of GAD1/GAD67. Has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. Not involved in deubiquitination of monoubiquitinated FANCD2.
  • Tissue specificity
    Broadly expressed.
  • Sequence similarities
    Belongs to the peptidase C19 family. USP12/USP46 subfamily.
  • Information by UniProt

Images

  • ab163895 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163895 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up