Overview

  • Product name
    Recombinant Human USPL1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LLSPTPVSTELSENGEGDFRYLGMGDSHIPPPVPSEFNDVSQNTHLRQDH NYCSPTKKNPCEVQPDSLTNNACVRTLNLESPMKTDIFDEFFSSSALNAL
    • Amino acids
      975 to 1074
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160880 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA121O19.1
    • C13orf22
    • D030048C09
    • D13S106
    • D13S106E
    • DKFZp781K2286
    • E430026A01Rik
    • FLJ32952
    • Highly charged protein
    • OTTHUMP00000018203
    • RGD1310835
    • RP11-121O19.1
    • Ubiquitin specific peptidase like 1
    • Ubiquitin specific peptidase like protein 1
    • Ubiquitin-specific peptidase-like protein 1
    • USPL 1
    • Uspl1
    • USPL1_HUMAN
    see all
  • Sequence similarities
    Belongs to the peptidase C19 family.
  • Information by UniProt

Images

  • ab160880 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160880 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160880.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up