Recombinant Human Uteroglobin protein (ab112370)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLPQ KPRESIIKLMEKIAQSSLCN
    • Molecular weight
      35 kDa including tags
    • Amino acids
      22 to 91

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112370 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    ab112370 is best used within three months from the date of receipt.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Blastokinin
    • CC10
    • CC16
    • CCPBP
    • CCSP
    • Clara cell phospholipid binding protein
    • Clara cell phospholipid-binding protein
    • Clara cell specific 10 kD protein
    • Clara cells 10 kDa secretory protein
    • OTTHUMP00000236107
    • SCGB1A1
    • Secretoglobin family 1A member 1
    • Secretoglobin, family 1A, member 1 (uteroglobin)
    • UG
    • UGB
    • UP-1
    • UP1
    • Urinary protein 1
    • Urine protein 1
    • UTER_HUMAN
    • Uteroglobin
    see all
  • Function
    Binds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2.
  • Tissue specificity
    Clara cells (nonciliated cells of the surface epithelium of the pulmonary airways).
  • Sequence similarities
    Belongs to the secretoglobin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab112370 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab112370 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112370.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up