Recombinant Human Utrophin protein (ab159789)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LEARMQILEDHNKQLESQLHRLRQLLEQPESDSRINGVSPWASPQHSALS YSLDPDASGPQFHQAAGEDLLAPPHDTSTDLTEVMEQIHSTFPSCCPNVP SRPQAM
    • Amino acids
      3328 to 3433
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DMDL
    • DRP
    • DRP 1
    • DRP-1
    • DRP1
    • Dystrophin like protein
    • Dystrophin related protein
    • Dystrophin related protein 1
    • Dystrophin-related protein 1
    • FLJ23678
    • OTTHUMP00000040139
    • UTRN
    • UTRO_HUMAN
    • Utrophin
    • Utrophin (homologous to dystrophin)
    see all
  • Function
    May play a role in anchoring the cytoskeleton to the plasma membrane.
  • Tissue specificity
    Muscle.
  • Sequence similarities
    Contains 2 CH (calponin-homology) domains.
    Contains 20 spectrin repeats.
    Contains 1 WW domain.
    Contains 1 ZZ-type zinc finger.
  • Cellular localization
    Cell junction > synapse > postsynaptic cell membrane. Cytoplasm > cytoskeleton. Neuromuscular junction.
  • Information by UniProt

Images

  • ab159789 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159789 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up