Overview

  • Product name
    Recombinant Human UTS2D protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNKILSSTVCFGLLTLLSVLIFLQSVHGRPYLTQGNEIFPDKKYTNREEL LLALLNKNFDFQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAV DGLFSSHPSKRACFWKYCV
    • Amino acids
      1 to 119
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166080 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC138371
    • Prepro URP
    • U-IIB
    • U2B
    • UIIB
    • urotensin 2 domain containing
    • Urotensin 2 domain containing protein
    • urotensin 2 related peptide
    • urotensin 2B
    • Urotensin II domain containing protein
    • urotensin II related peptide
    • Urotensin II-related peptide
    • Urotensin IIB
    • Urotensin-2 domain-containing protein
    • Urotensin-2B
    • URP
    • UTS2B
    • UTS2B_HUMAN
    • Uts2d
    see all
  • Function
    Potent vasoconstrictor.
  • Sequence similarities
    Belongs to the urotensin-2 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab166080 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166080 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166080.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up