Overview

  • Product nameRecombinant Human v-Myb protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP10243
    • SpeciesHuman
    • SequenceKSLVLDNWEKEESGTQLLTEDISDMQSENRFTTSLLMIPLLEIHDNRCNL IPEKQDINSTNKTYTLTKKKPNPNTSKVVKLEKNLQSNCEWETVVYGKTE DQLIMTEQAR
    • Molecular weight38 kDa including tags
    • Amino acids625 to 734

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116975 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A-Myb
    • AMYB
    • MGC120059
    • MGC120061
    • Myb related protein A
    • Myb-like protein 1
    • Myb-related protein A
    • MYBA_HUMAN
    • MYBL1
    see all
  • FunctionStrong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells.
  • Tissue specificityExpressed in a variety of lymphoid and solid tumor lines cultured in vitro.
  • Sequence similaritiesContains 3 HTH myb-type DNA-binding domains.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human v-Myb protein images

  • 12.5% SDS-PAGE showing ab116975 at approximately 37.73kDa.
    Stained with Coomassie Blue.

References for Recombinant Human v-Myb protein (ab116975)

ab116975 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116975.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"