Overview

  • Product name
    Recombinant Human VAM1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLE AVSDNNLELVNEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVA SKCYDSPPSSPEMNNSSINNQLLPVDAIRILGIHKRAGEPLGVTFRVENN DLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGS VTLKILPSYRDTITPQQVFVKCHFDYNPYNDNLIPCKEAGLKFSKGEILQ IVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGT ISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVG RRSLKNRFIVLNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIK AGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFM PYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAY NHYFDLIIINDNLDKAFEKLQTAIEKLRMEPQWVPISWVY
    • Amino acids
      1 to 540
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162634 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MAGUK p55 subfamily member 6
    • MAGUK p55 subfamily member 6 VELI associated MAGUK 1
    • MAGUK protein p55T
    • Membrane protein palmitoylated 6
    • Mpp6
    • MPP6_HUMAN
    • p55T
    • Palmitoylated 6 MAGUK p55 subfamily member 6
    • PALS2
    • Protein associated with Lin7 2
    • VAM-1
    • VELI associated MAGUK 1
    • Veli-associated MAGUK 1
    see all
  • Tissue specificity
    Abundant in testis, brain, and kidney with lower levels detectable in other tissues.
  • Sequence similarities
    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 2 L27 domains.
    Contains 1 PDZ (DHR) domain.
    Contains 1 SH3 domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab162634 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162634 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162634.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up