Recombinant Human VANGL1 protein (ab164370)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLT ASKFRAAKHMAGLKVYNVDGPSNNA
    • Amino acids
      247 to 321
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164370 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ANGL planar cell polarity protein 1
    • KAI1 C-terminal interacting tetraspanin
    • KITENIN
    • Loop tail protein 2 homolog
    • Loop-tail protein 2 homolog
    • LPP2
    • MGC5338
    • STB2
    • STBM2
    • Strabismus 2
    • Strabismus, Drosophila, homolog of, 2
    • Van Gogh like protein 1
    • Van Gogh, Drosophila, homolog of, 1
    • Van Gogh-like protein 1
    • Vang like 1 (van gogh, Drosophila)
    • Vang like protein 1
    • Vang-like 1
    • Vang-like protein 1
    • VANG1_HUMAN
    • VANGL 1
    • Vangl1
    see all
  • Tissue specificity
    Accordiing to PubMed:11956595, ubiquitously expressed. According to PubMed:12011995, expressed specifically in testis and ovary.
  • Involvement in disease
    Defects in VANGL1 are a cause of neural tube defects (NTD) [MIM:182940]. NTD are congenital malformations. The most common forms of NTD are described as open defects (including anencephaly and myelomeningocele, or spina bifida), which result from the failure of fusion in the cranial and spinal region of the neural tube, respectively. Other open dysraphisms (including myeloschisis, hemimyelomeningocele, and hemimyelocele) are sometimes associated with a Chiari type 2 malformation. A number of skin-covered (closed) NTD are categorized clinically depending on the presence of a subcutaneous mass (lipomyeloschisis, lipomyelomeningocele, meningocele, and myelocystocele) or the absence of such a mass (complex dysraphic states, including split cord malformations, dermal sinus, caudal regression, and segmental spinal dysgenesis).
    Defects in VANGL1 are a cause of sacral defect with anterior meningocele (SDAM) [MIM:600145]. SDAM is a form of caudal dysgenesis. It is present at birth and becomes symptomatic later in life, usually because of obstructive labor in females, chronic constipation, or meningitis. Inheritance is autosomal dominant.
  • Sequence similarities
    Belongs to the Vang family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab164370 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164370 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164370.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up