Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTR GVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSH
    • Amino acids
      351 to 450
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160133 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Amine oxidase, copper containing 3 (vascular adhesion protein 1)
    • AOC3
    • AOC3_HUMAN
    • Copper amine oxidase
    • HPAO
    • Membrane copper amine oxidase
    • Membrane primary amine oxidase
    • Semicarbazide sensitive amine oxidase
    • Semicarbazide-sensitive amine oxidase
    • SSAO
    • VAP-1
    • Vascular adhesion protein 1
    • VP97
    see all
  • Function
    Cell adhesion protein that participates in lymphocyte recirculation by mediating the binding of lymphocytes to peripheral lymph node vascular endothelial cells in an L-selectin-independent fashion. Has a monoamine oxidase activity. May play a role in adipogenesis.
  • Tissue specificity
    Strongly expressed on the high endothelial venules of peripheral lymph nodes and on hepatic endothelia. Also highly expressed in appendix, lung and small intestine. Expressed also in adipose tissue, in bone marrow, colon, heart, kidney, ovary, pancreas, placenta, prostate, skeletal muscle, spleen and testis.
  • Sequence similarities
    Belongs to the copper/topaquinone oxidase family.
  • Post-translational
    modifications
    Topaquinone (TPQ) is generated by copper-dependent autoxidation of a specific tyrosyl residue.
    N- and O-glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160133 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160133 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160133.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up