Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFG TAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPAN YVEEDYSEYC
    • Amino acids
      681 to 790
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159795 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Oncogene vav
    • p95Vav
    • Proto-oncogene vav
    • Protooncogene vav
    • VAV
    • VAV 1
    • VAV 1 oncogene
    • Vav proto oncogene
    • VAV_HUMAN
    • VAV1
    see all
  • Function
    Couples tyrosine kinase signals with the activation of the Rho/Rac GTPases, thus leading to cell differentiation and/or proliferation.
  • Tissue specificity
    Widely expressed in hematopoietic cells but not in other cell types.
  • Sequence similarities
    Contains 1 CH (calponin-homology) domain.
    Contains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 SH2 domain.
    Contains 2 SH3 domains.
  • Domain
    The DH domain is involved in interaction with CCPG1.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues.
  • Information by UniProt

Images

  • ab159795 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159795 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159795.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up