Overview

  • Product name
    Recombinant Human VAX2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGDGGAERDRGPARRAESGGGGGRCGDRSGAGDLRADGGGHSPTEVAGTS ASSPAGSRESGADSDGQPGPGEADHCRRILVRDAKGTIREIVLPKGLDLD RPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWF QNRRTKQKKDQSRDLEKRASSSASEAFATSNILRLLEQGRLLSVPRAPSL LALTPSLPGLPASHRGTSLGDPRNSSPRLNPLSSASASPPLPPPLPAVCF SSAPLLDLPAGYELGSSAFEPYSWLERKVGSASSCKKANT
    • Amino acids
      1 to 290
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161793 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DRES93
    • VAX2
    • Ventral anterior homeobox 2
  • Relevance
    VAX2 belongs to the EMX homeobox family and contains 1 homeobox DNA-binding domain. VAX2 gene has high sequence similarity to VAX1 gene and is almost exclusively expressed in the ventral portion of the retina during development. It may play an important role in morphogenetic processes underlying the correct development of the eye, particularly in the establishment of a correct dorsoventral pattern and may be a regulator of axial polarization in the retina.
  • Cellular localization
    Nuclear

Images

  • ab161793 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161793 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161793.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up