Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTN EGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHL SGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSL ETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISP KNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGN ATLTLIAMRMEDSGIYVCEGVNLIGKNRKEVELIVQEKPFTVEISPGPRI AAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPV SFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSSVTV SCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPT IEDTGKALVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSI LEEGSSVNMTCLSQGFPAPKILWSRQLPNGELQPLSENATLTLISTKMED SGVYLCEGINQAGRSRKEVELIIQVTPKDIKLTAFPSESVKEGDTVIISC TCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNK VGSQLRSLTLDVQGRENNKDYFSPEVDHHHHHH
    • Molecular weight
      75 kDa including tags
    • Amino acids
      25 to 698
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151357 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 94% Phosphate Buffer, 0.02% Calcium chloride, 5% Trehalose, 0.02% Magnesium chloride, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • CD106
    • CD106 Antigen
    • INCAM 100
    • INCAM-100
    • L1CAM
    • MGC99561
    • V-CAM 1
    • Vascular Cell Adhesion Molecule 1
    • Vascular cell adhesion protein 1
    • VCAM 1
    • VCAM-1
    • VCAM1
    • VCAM1_HUMAN
    see all
  • Function
    Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with the beta-1 integrin VLA4 on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/VLA4 interaction may play a pathophysiologic role both in immune responses and in leukocyte emigration to sites of inflammation.
  • Tissue specificity
    Expressed on inflammed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflammed tissue.
  • Sequence similarities
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain
    Either the first or the fourth Ig-like C2-type domain is required for VLA4-dependent cell adhesion.
  • Post-translational
    modifications
    Sialoglycoprotein.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab151357 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151357.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up