Recombinant Human VE Cadherin protein (ab112269)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP33151
    • SpeciesHuman
    • SequenceWNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETG DVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPV
    • Molecular weight37 kDa including tags
    • Amino acids51 to 150
    • TagsGST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112269 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    Peptide Array

    Western blot

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • 7B 4
    • 7B4
    • 7B4 antigen
    • CADH5_HUMAN
    • Cadherin 5
    • Cadherin 5 type 2
    • Cadherin 5, type 2 (vascular endothelium)
    • Cadherin 5, type 2, VE cadherin (vascular epithelium)
    • cadherin, vascular endothelial
    • cadherin, vascular endothelial, 1
    • Cadherin-5
    • Cadherin5
    • CD 144
    • CD144
    • CD144 antigen
    • CDH 5
    • CDH5
    • CDH5 protein
    • Endothelial specific cadherin
    • FLJ17376
    • OTTHUMP00000174777
    • Vascular endothelial cadherin
    • Vascular epithelium cadherin
    • VE Cad
    • VE-cadherin
    • VEC
    see all
  • FunctionCadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. This cadherin may play a important role in endothelial cell biology through control of the cohesion and organization of the intercellular junctions. It associates with alpha-catenin forming a link to the cytoskeleton.
  • Tissue specificityEndothelial tissues and brain.
  • Sequence similaritiesContains 5 cadherin domains.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues by KDR/VEGFR-2. Dephosphorylated by PTPRB.
  • Cellular localizationCell junction. Cell membrane. Found at cell-cell boundaries and probably at cell-matrix boundaries.
  • Information by UniProt

Recombinant Human VE Cadherin protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human VE Cadherin protein (ab112269)

ab112269 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112269.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"