Recombinant Human VE Cadherin protein (ab112269)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      WNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETG DVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPV
    • Molecular weight
      37 kDa including tags
    • Amino acids
      51 to 150
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112269 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    Peptide Array

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • 7B 4
    • 7B4
    • 7B4 antigen
    • CADH5_HUMAN
    • Cadherin 5
    • Cadherin 5 type 2
    • Cadherin 5, type 2 (vascular endothelium)
    • Cadherin 5, type 2, VE cadherin (vascular epithelium)
    • cadherin, vascular endothelial
    • cadherin, vascular endothelial, 1
    • Cadherin-5
    • Cadherin5
    • CD 144
    • CD144
    • CD144 antigen
    • CDH 5
    • CDH5
    • CDH5 protein
    • Endothelial specific cadherin
    • FLJ17376
    • OTTHUMP00000174777
    • Vascular endothelial cadherin
    • Vascular epithelium cadherin
    • VE Cad
    • VE-cadherin
    • VEC
    see all
  • Function
    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. This cadherin may play a important role in endothelial cell biology through control of the cohesion and organization of the intercellular junctions. It associates with alpha-catenin forming a link to the cytoskeleton.
  • Tissue specificity
    Endothelial tissues and brain.
  • Sequence similarities
    Contains 5 cadherin domains.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues by KDR/VEGFR-2. Dephosphorylated by PTPRB.
  • Cellular localization
    Cell junction. Cell membrane. Found at cell-cell boundaries and probably at cell-matrix boundaries.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab112269 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112269.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up