Recombinant human VEGF Receptor 1 protein (ab54346)

Overview

Description

  • NatureRecombinant
  • SourceInsect cells
  • Amino Acid Sequence
    • AccessionP17948-2
    • SpeciesHuman
    • SequenceSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERL SITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAI YIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPL DTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHR QTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNK RASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNT SVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVKAFPSPEVVWLKDGL PATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTATLIV NVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHN HSEARCDFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVV ADSRISGIYICIASNKVGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLK LSCTVNKFLYRDVTWILLRTVNNRTMHYSISKQKMAITKEHSITLNLTIM NVSLQDSGTYACRARNVYTGEEILQKKEITIRGEHCNKKAVFSRISKFKS TRNDCTTQSNVKH
    • Amino acids25 to 688
    • Additional sequence informationVEGF Receptor 1 isoform 2 without the signal peptide

Specifications

Our Abpromise guarantee covers the use of ab54346 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The activity of sVEGFR-1 was determined by its ability to inhibit the VEGF-A-induced proliferation of HUVECs.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 90 % SDS-PAGE.
    Purified protein was visualised by Silver stain.
  • FormLyophilised
  • Additional notes

    The lyophilized sVEGFR-1 is soluble in water and most aqueous buffers.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Buffer: None
    Endotoxin level:< 0.1 ng per µg of sVEGFR1

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionThis protein should be reconstituted in PBS to a concentration not lower than 100 ng/ml.

General Info

  • Alternative names
    • EC 2.7.10.1
    • FLT
    • FLT 1
    • Flt-1
    • FLT1
    • Fms like tyrosine kinase 1
    • Fms related tyrosine kinase 1
    • Fms related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor)
    • Fms related tyrosine kinase 1 vascular endothelial growth factor/vascular permeability factor receptor
    • Fms-like tyrosine kinase 1
    • FRT
    • Soluble VEGF receptor 1 14
    • Soluble VEGFR1 variant 2
    • Soluble VEGFR1 variant 21
    • Tyrosine protein kinase FRT
    • Tyrosine protein kinase receptor FLT
    • Tyrosine-protein kinase FRT
    • Tyrosine-protein kinase receptor FLT
    • Vascular endothelial growth factor receptor 1
    • Vascular endothelial growth factor vascular permeability factor receptor
    • Vascular permeability factor receptor
    • Vascular permeability factor receptor 1
    • VEGFR 1
    • VEGFR-1
    • VEGFR1
    • VGFR1_HUMAN
    see all
  • FunctionReceptor for VEGF, VEGFB and PGF. Has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. Isoform SFlt1 may have an inhibitory role in angiogenesis.
  • Tissue specificityMostly in normal lung, but also in placenta, liver, kidney, heart and brain tissues. Specifically expressed in most of the vascular endothelial cells, and also expressed in peripheral blood monocytes. Isoform sFlt1 is strongly expressed in placenta.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localizationSecreted and Cell membrane.
  • Information by UniProt

Recombinant human VEGF Receptor 1 protein images

  • SDS Page analysis of ab54346.

References for Recombinant human VEGF Receptor 1 protein (ab54346)

ab54346 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your enquiry regarding ab106041 and for taking the time to provide some useful details of the experiments. I am very sorry to hear that you are having problems with this antibody.

After reading through the detailed protocol you k...

Read More

Thank you for contacting us.

The antibodies are viable for 10 years when stored at -20C, for 1 year when stored at 4C.

Please note that we recommend storing the antibodies at 4C for 1-2 weeks only. Some antibodies are prone to degrada...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"