Recombinant Human VEGF Receptor 3 protein (ab54260)

Overview

Description

  • NatureRecombinant
  • SourceInsect cells
  • Amino Acid Sequence
    • AccessionP35916
    • SpeciesHuman
    • SequenceDPSGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPAT GDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARI EGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLR SQSSVLWPDGQEVVWDDRRGMLVSTPLLHDALYLQCETTWGDQDFLSNPF LVHITGNELYDIQLLPRKSLELLVGEKLVLNCTVWAEFNSGVTFDWDYPG KQAERGKWVPERRSQQTHTELSSILTIHNVSQHDLGSYVCKANNGIQRFR ESTEVIVHENPFISVEWLKGPILEATAGDELVKLPVKLAAYPPPEFQWYK DGKALSGRHSPHALVLKEVTEASTGTYTLALWNSAAGLRRNISLELVVNV PPQIHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIQWHWRPWTPCKMFA QRSLRRRQQQDLMPQCRDWRAVTTQDAVNPIESLDTWTEFVEGKNKTVSK LVIQNANVSAMYKCVVSNKVGQDERLIYFYVTTIPDGFTIESKPSEELLE GQPVLLSCQADSYKYEHLRWYRLNLSTLHDAHGNPLLLDCKNVHLFATPL AASLEEVAPGARHATLSLSIPRVAPEHEGHYVCEVQDRRSHDKHCHKKYL SVQALEAPRLTQNLTDLLVNVSDSLEMQCLVAGAHAPSIVWYKDERLLEE KSGVDLADSNQKLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSED KGSMEHDPSGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWAWPGA QEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYK YIKARIEGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPG LNVTLRSQSSVLWPDGQEVVWDDRRGMLVSTPLLHDALYLQCETTWGDQD FLSNPFLVHITGNELYDIQLLPRKSLELLVGEKLVLNCTVWAEFNSGVTF DWDYPGKQAERGKWVPERRSQQTHTELSSILTIHNVSQHDLGSYVCKANN GIQRFRESTEVIVHENPFISVEWLKGPILEATAGDELVKLPVKLAAYPPP EFQWYKDGKALSGRHSPHALVLKEVTEASTGTYTLALWNSAAGLRRNISL ELVVNVPPQIHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIQWHWRPWT PCKMFAQRSLRRRQQQDLMPQCRDWRAVTTQDAVNPIESLDTWTEFVEGK NKTVSKLVIQNANVSAMYKCVVSNKVGQDERLIYFYVTTIPDGFTIESKP SEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHDAHGNPLLLDCKNVH LFATPLAASLEEVAPGARHATLSLSIPRVAPEHEGHYVCEVQDRRSHDKH CHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMQCLVAGAHAPSIVWYKD ERLLEEKSGVDLADSNQKLSIQRVREEDAGRYLCSVCNAKGCVNSSASVA VEGSEDKGSMEHHHHHH
    • Molecular weight110 kDa
    • Amino acids23 to 775
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab54260 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 90 % SDS-PAGE.
    ab54260 purity is > 90%, by SDS-PAGE and visualised by silver stain. Endotoxin level: < 0.1 ng per ug of sVEGFR3
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Buffer: None

  • ReconstitutionReconstitute in PBS or culture medium to a concentration not lower than 100µg/ml.

General Info

  • Alternative names
    • EC 2.7.10.1
    • flt 4
    • FLT-4
    • FLT4
    • FLT41
    • Fms related tyrosine kinase 4
    • Fms-like tyrosine kinase 4
    • LMPH1A
    • PCL
    • Soluble VEGFR3 variant 1
    • Soluble VEGFR3 variant 2
    • Soluble VEGFR3 variant 3
    • Tyrosine protein kinase receptor FLT4
    • Tyrosine-protein kinase receptor FLT4
    • Vascular endothelial growth factor receptor 3
    • Vascular endothelial growth factor receptor 3 precursor
    • VEGF R3
    • VEGFR 3
    • VEGFR-3
    • VEGFR3
    • VGFR3_HUMAN
    see all
  • FunctionReceptor for VEGFC. Has a tyrosine-protein kinase activity.
  • Tissue specificityPlacenta, lung, heart, and kidney, does not seem to be expressed in pancreas and brain.
  • Involvement in diseaseDefects in FLT4 are the cause of lymphedema hereditary type 1A (LMPH1A) [MIM:153100]; also known as Nonne-Milroy lymphedema or Milroy disease. Hereditary lymphedema is a chronic disabling condition which results in swelling of the extremities due to altered lymphatic flow. Patients with lymphedema suffer from recurrent local infections and physical impairment.
    Note=Defects in FLT4 are found in juvenile hemangioma. Juvenile hemangiomas are the most common tumors of infancy, occurring as many as 10% of all births. These benign vascular lesions enlarge rapidly during the first year of life by hyperplasia of endothelial cells and attendant pericytes, and then spontaneously involute over a period of years, leaving loose fibrofatty tissue.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human VEGF Receptor 3 protein images

  • SDS-PAGE  of recombinant human soluble VEGFR-3/FLT-4. The sample was loaded in 10% SDS-polyacrylamide gel under reducing condition and stained with Silver stain.

References for Recombinant Human VEGF Receptor 3 protein (ab54260)

ab54260 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab54260.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"